Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda-1 light chain (IGL1)

This Recombinant Human Immunoglobulin lambda-1 light chain (IGL1) spans the amino acid sequence from region 1-216. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda-1 light chain; Immunoglobulin lambda-1 light chain MCG

UniProt

P0DOX8

Expression Region

1-216

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Annexin A5 (ANXA5) ELISA Kit
RD-ANXA5-Hu-01 96 Tests

Human Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
Human Annexin A5 (ANXA5) ELISA Kit
RD-ANXA5-Hu-02 48 Tests

Human Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
Anti-GSTM2 Antibody Picoband® Cy3 Conjugated
A04423-2-Cy3 100 µg/Vial

Anti-GSTM2 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Naloxone hydrochloride dihydrate
GP1662-250mg 250 mg

Naloxone hydrochloride dihydrate

Sign In for Pricing
View Details
SZL P1-41
BUP03682-01 5 mg

SZL P1-41

Sign In for Pricing
View Details
SZL P1-41
BUP03682-02 10 mg

SZL P1-41

Sign In for Pricing
View Details