Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108)

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THTPA (Thiamine-triphosphatase, ThTPase, THTP) (APC)
134428-APC 100 µL

THTPA (Thiamine-triphosphatase, ThTPase, THTP) (APC)

Sign In for Pricing
View Details
CARD17 Polyclonal Antibody, APC-Cy7 Conjugated
bs-7090R-APC-Cy7 100 µL

CARD17 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
CD8A Antibody (FITC)
orb1271614 25 Tests

CD8A Antibody (FITC)

Sign In for Pricing
View Details
Ca2+ channel P/Q-type alpha-1A polyclonal rabbit affinity purified
152 103 50 µg

Ca2+ channel P/Q-type alpha-1A polyclonal rabbit affinity purified

Sign In for Pricing
View Details
Tas2r110 Recombinant Protein (Rat)
RP232304 100 µg

Tas2r110 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Neurochondrin Rabbit Polyclonal Antibody (BF555)
orb2471703 100 µL

Neurochondrin Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details