Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd52 Mouse Gene Knockout Kit (CRISPR)
KN502925 1 Kit

Cd52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Allylidene-10,11-dihydro-5H-dibenzo[a,d][7]annulene (Stabilized with Hydroquinone)
TRC-A552600-10MG 10 mg

5-Allylidene-10,11-dihydro-5H-dibenzo[a,d][7]annulene (Stabilized with Hydroquinone)

Sign In for Pricing
View Details
Polystyrene M RAM
HAM2023.5G 5 g

Polystyrene M RAM

Sign In for Pricing
View Details
Mouse ARG1 Antibody Pair Set
E-KAB-0582 50 µL & 100 µg

Mouse ARG1 Antibody Pair Set

Sign In for Pricing
View Details
Ttc39d Mouse Gene Knockout Kit (CRISPR)
KN518423 1 Kit

Ttc39d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (VIM/1937R), CF568 conjugate, 0.1mg/mL
BNC681937-100 1x 100 µL

Vimentin (Mesenchymal Cell Marker) (VIM/1937R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details