Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SCARF2 activation kit by CRISPRa
GA114093 1 Kit

Human SCARF2 activation kit by CRISPRa

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF740 conjugate, 0.1mg/mL
BNC740488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat IL17RA Protein (Fc Tag)
PKSR030332 100 µg

Recombinant Rat IL17RA Protein (Fc Tag)

Sign In for Pricing
View Details
Nephronophthisis (NPHP1) (NM_001128179) Human Over-expression Lysate
LY426916 100 µg

Nephronophthisis (NPHP1) (NM_001128179) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843B-01 25 µg

Biotin Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Biotin Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843B-02 100 µg

Biotin Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details