Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33)

This Recombinant Human Immunoglobulin heavy variable 3-30-3 (HVC33) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-3 IGHV3-30-3

UniProt

P0DP02

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human INHBA qPCR Primer Pair
QH03785S 200 Tests

Human INHBA qPCR Primer Pair

Sign In for Pricing
View Details
HDAC9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B8]
TA805323AM 100 µL

HDAC9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B8]

Sign In for Pricing
View Details
TMED2 (NM_006815) Human Tagged ORF Clone Lentiviral Particle
RC206849L3V 200 µL

TMED2 (NM_006815) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Myt1l (NM_001093775) Mouse Tagged ORF Clone Lentiviral Particle
MR224643L3V 200 µL

Myt1l (NM_001093775) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SIX1 (Homeobox Protein SIX1)
491781 100 µL

SIX1 (Homeobox Protein SIX1)

Sign In for Pricing
View Details
Lentiviral mouse Sephs2 shRNA (UAS) - Lentiviral mouse Sephs2 shRNA (UAS, RFP) (100)
GTR15241452 1 Vial

Lentiviral mouse Sephs2 shRNA (UAS) - Lentiviral mouse Sephs2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details