Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEMK1 Polyclonal Antibody
E-AB-90443-01 60 µL

HEMK1 Polyclonal Antibody

Sign In for Pricing
View Details
HEMK1 Polyclonal Antibody
E-AB-90443-02 120 µL

HEMK1 Polyclonal Antibody

Sign In for Pricing
View Details
HEMK1 Polyclonal Antibody
E-AB-90443-03 200 µL

HEMK1 Polyclonal Antibody

Sign In for Pricing
View Details
RBM3 (NM_006743) Human Recombinant Protein
TP760298 50 µg

RBM3 (NM_006743) Human Recombinant Protein

Sign In for Pricing
View Details
6-Hydroxymelatonin Glucuronide
TRC-H944620-5MG 5 mg

6-Hydroxymelatonin Glucuronide

Sign In for Pricing
View Details
ARHGAP20 Human Gene Knockout Kit (CRISPR)
KN418211 1 Kit

ARHGAP20 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details