Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINA11 Rabbit Polyclonal Antibody
TA367249 100 µL

SERPINA11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDE1B (NM_001165975) Human Over-expression Lysate
LC431450 20 µg

PDE1B (NM_001165975) Human Over-expression Lysate

Sign In for Pricing
View Details
Tebufenozide
TRC-T013200-250MG 250 mg

Tebufenozide

Sign In for Pricing
View Details
NCKAP5 Human Gene Knockout Kit (CRISPR)
KN415542 1 Kit

NCKAP5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C16orf44 (KLHL36) (NM_024731) Human Recombinant Protein
TP307468L 1 mg

C16orf44 (KLHL36) (NM_024731) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS507705 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details