Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431)

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XM Protein Vector (Human) (pPM-C-HA)
50549021 500 ng

XM Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GNAI1 CRISPRa sgRNA lentivector (set of three targets)(Human)
22296121 3x 1.0µg DNA

GNAI1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Ighg1 (BC024405) Mouse Tagged ORF Clone Lentiviral Particle
MR207509L4V 200 µL

Ighg1 (BC024405) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mon1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
30305116 3x 1.0 µg

Mon1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rat Monoclonal BAFF Receptor Antibody (7J21) [DyLight 550]
NBP2-22005R 0.1 mL

Rat Monoclonal BAFF Receptor Antibody (7J21) [DyLight 550]

Sign In for Pricing
View Details
ALDOB (16Y12) Rabbit Monoclonal Antibody
E28M3629 100 µL

ALDOB (16Y12) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details