Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial

This Recombinant Human V-set and immunoglobulin domain-containing protein 10-like 2 (VSXL2), partial spans the amino acid sequence from region 29-703. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V-set and immunoglobulin domain-containing protein 10-like 2 VSIG10L2

UniProt

P0DP72

Expression Region

29-703

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPHPTPEAPVEEVVSVQGVRGGSVELACGSGPAPLLVLWSFTPLGSLVPRPVAVTDGAMSKVEAIASALGVVSLRNSSLVLGELHEGARGHFLCQVLHVAGGQLHAAYSHLTLAVLVPVSKPQVRLSNPSPVEGASVVATCAVREGTEPVTFAWQHRAPRGLGEALVGVTEPLFQLDPVNRTHLGWYMCSASNSVNRLSSDGAFLDVIYGPDKPVITMEPLGLTEEGFWASEREEVTLSCLAASNPPSHYVWLRDHTQVHTGPTYVIARAGRVHTGLYTCLARNSYLDTRTQTTVQLTIYYPPEGQPSCAVHPSPEAVTLLCAWPGGLPPAQLQWEGPQGPGPTAPSNVTWSHAAAQLPSGSVFTCTGQHPALAPPALCTVMLWEPLGRPTCWSTATMGDQFIMLSCEWPGGEPPATLGWLDEQQQPLGGSSSSMAVHLLQAQEDLAGREFTCRGTHLLRTPDPHCHLQLEAPQLDVAEPRVSVLEGGEAWLECSLRGGTPPAQLLWLGPQQQKVDPGTSGFMLHPEGAQLRLGIYDADPAHHRGTYQCVARNAVGNSSQSVLLEVLRYPAPPNVTISRLTYGRHRREVQLQWAILGPGNLTGFLVQRKASALGPGAGAWETAASDIEPESRGRRLGGLDPGVLYAFRILALNHHTAGHPSEVKIPADPPFSAYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17Alpha-Trifluoroacetoxyfuticasone 17Beta-Carboxylic Acid
TRC-T781010-25MG 25 mg

17Alpha-Trifluoroacetoxyfuticasone 17Beta-Carboxylic Acid

Sign In for Pricing
View Details
Purified anti-human CD140b (PDGFRβ) Recombinant
GT15899 100 µg

Purified anti-human CD140b (PDGFRβ) Recombinant

Sign In for Pricing
View Details
Human Spondin-1/SPON1, C-His Tag
HA210596-01 20 µg

Human Spondin-1/SPON1, C-His Tag

Sign In for Pricing
View Details
Human Spondin-1/SPON1, C-His Tag
HA210596-02 50 µg

Human Spondin-1/SPON1, C-His Tag

Sign In for Pricing
View Details
Human Spondin-1/SPON1, C-His Tag
HA210596-03 100 µg

Human Spondin-1/SPON1, C-His Tag

Sign In for Pricing
View Details
Mannosidase II (MAN2A1) (NM_002372) Human Over-expression Lysate
E45H06155-2 20 µg

Mannosidase II (MAN2A1) (NM_002372) Human Over-expression Lysate

Sign In for Pricing
View Details