Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucosidase 2 subunit beta Rabbit Polyclonal Antibody
HA500152 100 µL

Glucosidase 2 subunit beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C16orf95 (NM_001195125) Human Over-expression Lysate
LC434000 20 µg

C16orf95 (NM_001195125) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS808864 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
FITC Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782C-01 20 Tests

FITC Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
FITC Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782C-02 100 Tests

FITC Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
FITC Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782C-03 2x 100 Tests

FITC Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details