Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Antibody
TA396682S 25 µL

Goat Polyclonal Antibody

Sign In for Pricing
View Details
Water Chiller BCHI-312
BCHI-312 Each

Water Chiller BCHI-312

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), 1mg/mL
BNUM1774-50 1x 50 µL

Chromogranin A / CHGA (Neuroendocrine Marker), 1mg/mL

Sign In for Pricing
View Details
UBL4A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D7]
TA502447BM 100 µL

UBL4A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D7]

Sign In for Pricing
View Details
Coelenterazine I
#10121 1x 50 µg

Coelenterazine I

Sign In for Pricing
View Details
MAG Polyclonal Antibody
E-AB-10442-01 20 µL

MAG Polyclonal Antibody

Sign In for Pricing
View Details