Recombinant Human Protein POLR1D, isoform 2 (RPC22)
This Recombinant Human Protein POLR1D, isoform 2 (RPC22) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein POLR1D, isoform 2 POLR1D
UniProt
P0DPB5
Expression Region
1-122
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7062881 Inquire
Recombinant Escherichia coli UPF0719 inner membrane protein yjfL (yjfL), partial
Sign In for Pricing
View Details 