Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NBPF family member NBPF9 (NBPF9), partial

This Recombinant Human NBPF family member NBPF9 (NBPF9), partial spans the amino acid sequence from region 1013-1111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NBPF family member NBPF9; Neuroblastoma breakpoint family member 9; NBPF9

UniProt

P0DPF3

Expression Region

1013-1111

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ERRRGRKEGEEDQNPPCPRLNGVLMEVEEPEVLQDSLDGCYSTPSMYFELPDSFQHYRSVFYSFEEQHISFALYVDNRFFTLTVTSLHLVFQMEVIFPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku-80 Polyclonal Antibody
ABP51685-01 30 µL

Ku-80 Polyclonal Antibody

Sign In for Pricing
View Details
Ku-80 Polyclonal Antibody
ABP51685-02 100 µL

Ku-80 Polyclonal Antibody

Sign In for Pricing
View Details
Ku-80 Polyclonal Antibody
ABP51685-03 200 µL

Ku-80 Polyclonal Antibody

Sign In for Pricing
View Details
Human anti-human CD81/TAPA-1 mAb (7K3)
A09C55-7K3 1 Each

Human anti-human CD81/TAPA-1 mAb (7K3)

Sign In for Pricing
View Details
VLDL Receptor Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-21401R-BF680 100 µL

VLDL Receptor Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
IFT20 Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1610874 100 µL

IFT20 Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details