Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 35 (TVA35)

This Recombinant Human T cell receptor alpha variable 35 (TVA35) spans the amino acid sequence from region 20-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 35 TRAV35

UniProt

P0DPF4

Expression Region

20-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2 (CBSCBSPB2)
MBS7010902-01 0.02 mg

Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2 (CBSCBSPB2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2 (CBSCBSPB2)
MBS7010902-02 0.1 mg

Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2 (CBSCBSPB2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2 (CBSCBSPB2)
MBS7010902-03 5x 0.1 mg

Recombinant Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2 (CBSCBSPB2)

Sign In for Pricing
View Details
Cdr2 (NM_007672) Mouse Untagged Clone
MC216103 10 µg

Cdr2 (NM_007672) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse ACTH (Adrenocorticotropic Hormone) ELISA Kit
EM20524 96 Tests

Mouse ACTH (Adrenocorticotropic Hormone) ELISA Kit

Sign In for Pricing
View Details
ATP6V1G2 Polyclonal Antibody, Cy3 Conjugated
bs-10930R-Cy3 100 µL

ATP6V1G2 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details