Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63)

This Recombinant Human T cell receptor beta variable 6-3 (TVB63) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUX1 Rabbit Polyclonal Antibody
orb587366 100 µL

DUX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRPS24P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
30568061 1.0 µg DNA

MRPS24P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ELISA Kit For Transmembrane gamma-carboxyglutamic acid protein 4
E1958h 96 Tests

ELISA Kit For Transmembrane gamma-carboxyglutamic acid protein 4

Sign In for Pricing
View Details
Mouse Monoclonal SHP-1 Antibody (PTPN6/7544) [Alexa Fluor 350]
NBP3-27000AF350 0.1 mL

Mouse Monoclonal SHP-1 Antibody (PTPN6/7544) [Alexa Fluor 350]

Sign In for Pricing
View Details
PDCD6 rabbit pAb
RA34032-01 50 µL

PDCD6 rabbit pAb

Sign In for Pricing
View Details
PDCD6 rabbit pAb
RA34032-02 100 µL

PDCD6 rabbit pAb

Sign In for Pricing
View Details