Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63)

This Recombinant Human T cell receptor beta variable 6-3 (TVB63) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tirap (NM_001177847) AAV Particle
MR225275A1V 250 µL

Mouse Tirap (NM_001177847) AAV Particle

Sign In for Pricing
View Details
LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) (MaxLight 405)
MBS6447520-01 0.1 mL

LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) (MaxLight 405)

Sign In for Pricing
View Details
LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) (MaxLight 405)
MBS6447520-02 5x 0.1 mL

LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Ribophorin I (RPN1)
SIPC268Hu03-01 10 µg

Recombinant Ribophorin I (RPN1)

Sign In for Pricing
View Details
Recombinant Ribophorin I (RPN1)
SIPC268Hu03-02 50 µg

Recombinant Ribophorin I (RPN1)

Sign In for Pricing
View Details
Recombinant Ribophorin I (RPN1)
SIPC268Hu03-03 200 µg

Recombinant Ribophorin I (RPN1)

Sign In for Pricing
View Details