Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DDIT3 upstream open reading frame protein (DT3UO)

This Recombinant Human DDIT3 upstream open reading frame protein (DT3UO) spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DDIT3 upstream open reading frame protein; Alternative DDIT3 protein; AltDDIT3; DDIT3

UniProt

P0DPQ6

Expression Region

1-34

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MANF shRNA (UAS) - Lentiviral human MANF shRNA (UAS, RFP) (25)
GTR15327638 1 Vial

Lentiviral human MANF shRNA (UAS) - Lentiviral human MANF shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ClpP Caseinolytic Peptidase Human Recombinant (CLPP Human)
PT_74541-01 2 µg

ClpP Caseinolytic Peptidase Human Recombinant (CLPP Human)

Sign In for Pricing
View Details
ClpP Caseinolytic Peptidase Human Recombinant (CLPP Human)
PT_74541-02 10 µg

ClpP Caseinolytic Peptidase Human Recombinant (CLPP Human)

Sign In for Pricing
View Details
ClpP Caseinolytic Peptidase Human Recombinant (CLPP Human)
PT_74541-03 1 mg

ClpP Caseinolytic Peptidase Human Recombinant (CLPP Human)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 21/FGF-21 (N-6His)
C223-50ug 50 µg

Recombinant Human Fibroblast Growth Factor 21/FGF-21 (N-6His)

Sign In for Pricing
View Details
Recombinant Arcobacter nitrofigilis 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA (cpdA)
MBS1105423-01 0.05 mg (E-Coli)

Recombinant Arcobacter nitrofigilis 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA (cpdA)

Sign In for Pricing
View Details