Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37)

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1D-37 IGKV1D-37

UniProt

P0DSN7

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CyDye DIGE Fluor Cy 2 Cation
TRC-C989180-50MG 50 mg

CyDye DIGE Fluor Cy 2 Cation

Sign In for Pricing
View Details
Fibroblast Growth Factor 9 (FGF9) Antibody
abx242104-01 50 µL

Fibroblast Growth Factor 9 (FGF9) Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor 9 (FGF9) Antibody
abx242104-02 100 µL

Fibroblast Growth Factor 9 (FGF9) Antibody

Sign In for Pricing
View Details
RUNX1/DUSP4
FP-481 100 µL - 10 Tests

RUNX1/DUSP4

Sign In for Pricing
View Details
HPS5 Antibody
E51A10776 100 µL

HPS5 Antibody

Sign In for Pricing
View Details
Panadiplon
M34371-01 1 g

Panadiplon

Sign In for Pricing
View Details