Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human APOBEC3H shRNA (UAS) - Lentiviral human APOBEC3H shRNA (UAS, RFP) (25)
GTR15155123 1 Vial

Lentiviral human APOBEC3H shRNA (UAS) - Lentiviral human APOBEC3H shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Zfp346 (NM_012017) Mouse Recombinant Protein
PM47535M5 20 µg

Zfp346 (NM_012017) Mouse Recombinant Protein

Sign In for Pricing
View Details
OR52N5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1569605 3x 1.0 µg

OR52N5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
OR10R2 Antibody
A14883-50UG 50 µg

OR10R2 Antibody

Sign In for Pricing
View Details
Recombinant Human IFIT3 Protein, N-His
E55P7549 50 µg

Recombinant Human IFIT3 Protein, N-His

Sign In for Pricing
View Details
Haptoglobin beta Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9888R-BF555 100 µL

Haptoglobin beta Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details