Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VTP-27999 2,2,2-trifluoroacetate 1mg
A15281-1 1 mg

VTP-27999 2,2,2-trifluoroacetate 1mg

Sign In for Pricing
View Details
DDX56 (NM_001257189) Human Untagged Clone
SC330573 10 µg

DDX56 (NM_001257189) Human Untagged Clone

Sign In for Pricing
View Details
Human ITIH1 Recombinant Protein (N-His)
HB950022-01 50 µg

Human ITIH1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ITIH1 Recombinant Protein (N-His)
HB950022-02 100 µg

Human ITIH1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ITIH1 Recombinant Protein (N-His)
HB950022-03 1 mg

Human ITIH1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Mmu-miR-6944-5p miRNA Agomir
CMN1355-01 5 nmol

Mmu-miR-6944-5p miRNA Agomir

Sign In for Pricing
View Details