Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38-3 (HV383) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38-3 IGHV3-38-3 IGHV3-D

UniProt

P0DTE1

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESRGVLVQPGGSLRLSCAASGFTVSSNEMSWVRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Chinese mitten crab Met Monoclonal Antibody (1A442)
MBS1586698-01 0.05 mg

Anti-Chinese mitten crab Met Monoclonal Antibody (1A442)

Sign In for Pricing
View Details
Anti-Chinese mitten crab Met Monoclonal Antibody (1A442)
MBS1586698-02 0.1 mg

Anti-Chinese mitten crab Met Monoclonal Antibody (1A442)

Sign In for Pricing
View Details
Anti-Chinese mitten crab Met Monoclonal Antibody (1A442)
MBS1586698-03 5x 0.1 mg

Anti-Chinese mitten crab Met Monoclonal Antibody (1A442)

Sign In for Pricing
View Details
Recombinant Human Diffuse panbronchiolitis critical region protein 1 (DPCR1), partial
MBS1432287-01 0.5 mg (E-Coli)

Recombinant Human Diffuse panbronchiolitis critical region protein 1 (DPCR1), partial

Sign In for Pricing
View Details
Recombinant Human Diffuse panbronchiolitis critical region protein 1 (DPCR1), partial
MBS1432287-02 0.05 mg (Baculovirus)

Recombinant Human Diffuse panbronchiolitis critical region protein 1 (DPCR1), partial

Sign In for Pricing
View Details
Recombinant Human Diffuse panbronchiolitis critical region protein 1 (DPCR1), partial
MBS1432287-03 0.5 mg (Yeast)

Recombinant Human Diffuse panbronchiolitis critical region protein 1 (DPCR1), partial

Sign In for Pricing
View Details