Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 8-51-1 (HV511) spans the amino acid sequence from region 18-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 8-51-1 IGHV8-51-1

UniProt

P0DTE2

Expression Region

18-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EAQLTESGGDLVHLEGPLRLSCAASWFTFSIYEIHWVCQASGKGLEWVAVIWRGESHQYNADYVRGRLTTSRDNTKYMLYMQMISLRTQNMAAFNCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmpo Mouse Gene Knockout Kit (CRISPR)
KN517929 1 Kit

Tmpo Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 (C117/370), 1mg/mL
BNUM0370-50 1x 50 µL

CD117 (C117/370), 1mg/mL

Sign In for Pricing
View Details
MYPT1 (Ab-696) Antibody
8B0517-AAT 50 µg

MYPT1 (Ab-696) Antibody

Sign In for Pricing
View Details
NAlpha-Boc-L-arginine Hydrochloride
TRC-B621325-5G 5 g

NAlpha-Boc-L-arginine Hydrochloride

Sign In for Pricing
View Details
Recombinant HNRNPM Antibody
RC-4601-01 50 μL

Recombinant HNRNPM Antibody

Sign In for Pricing
View Details
Recombinant HNRNPM Antibody
RC-4601-02 100 µL

Recombinant HNRNPM Antibody

Sign In for Pricing
View Details