Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 276 (TM276), partial

This Recombinant Human Transmembrane protein 276 (TM276), partial spans the amino acid sequence from region 135-192. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 276 TMEM276

UniProt

P0DTL5

Expression Region

135-192

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ANTYGMWGGAMLGVAGLLSRLEEDRLLLLPKEDVCRWALAVGSWAYCRALHTQRLQWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR7156 Human qPCR Primer Pair (MI0023616)
HP301516 200 Reactions

MIR7156 Human qPCR Primer Pair (MI0023616)

Sign In for Pricing
View Details
HAVCR2 antibody
FNab10125 100 µg

HAVCR2 antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501957 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
SmartReader™ UV-Vis Microplate Absorbance Reader with Cuvette Port, 230V
MR9611-E 1 Each

SmartReader™ UV-Vis Microplate Absorbance Reader with Cuvette Port, 230V

Sign In for Pricing
View Details
D,L-o-Tyrosine
TRC-T899980-1G 1 g

D,L-o-Tyrosine

Sign In for Pricing
View Details
IGF1R (Ab-1165/1166) Antibody
8B7115-AAT 50 µg

IGF1R (Ab-1165/1166) Antibody

Sign In for Pricing
View Details