Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger TRAF-type-containing protein 1 (ZTRF1)

This Recombinant Human Zinc finger TRAF-type-containing protein 1 (ZTRF1) spans the amino acid sequence from region 1-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger TRAF-type-containing protein 1; Cysteine and histidine-rich protein 1; ZFTRAF1 CYHR1 KIAA0496

UniProt

P0DTL6

Expression Region

1-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGAEEAGGGGPAAGPAGSVPAGVGVGVGAGPGAAAGQAAAAALGEAAGPGLPDEAGLAGARQLQLQEAAGDPDAPPKKRLRAAEAAEAAAAAAAAGSGKLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKNINLRLFLFQIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Granzyme K Antibody
CPA4909-01 30 µL

Anti-Granzyme K Antibody

Sign In for Pricing
View Details
Anti-Granzyme K Antibody
CPA4909-02 50 μL

Anti-Granzyme K Antibody

Sign In for Pricing
View Details
Anti-Granzyme K Antibody
CPA4909-03 100 µL

Anti-Granzyme K Antibody

Sign In for Pricing
View Details
Anti-Granzyme K Antibody
CPA4909-04 200 µL

Anti-Granzyme K Antibody

Sign In for Pricing
View Details
NAP1L4 protein (His tag)
80R-3023 100 ug

NAP1L4 protein (His tag)

Sign In for Pricing
View Details
CDHR5 Protein Vector (Human) (pPB-C-His)
PV068449 500 ng

CDHR5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details