Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasminogen-like protein B (PLGB)

This Recombinant Human Plasminogen-like protein B (PLGB) spans the amino acid sequence from region 20-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plasminogen-like protein B; Plasminogen-related protein B; PLGLB1 PLGL PRGB; PLGLB2 PLGP1

UniProt

Q02325

Expression Region

20-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT6 Rabbit Polyclonal Antibody (Biotin)
orb455347 100 µL

TRMT6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Complement Decay-Accelerating Factor (CD55) Antibody
abx421781-01 50 µg

Complement Decay-Accelerating Factor (CD55) Antibody

Sign In for Pricing
View Details
Complement Decay-Accelerating Factor (CD55) Antibody
abx421781-02 100 µg

Complement Decay-Accelerating Factor (CD55) Antibody

Sign In for Pricing
View Details
CD146 Rabbit Polyclonal Antibody
APRab00371-01 20 µL

CD146 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD146 Rabbit Polyclonal Antibody
APRab00371-02 50 µL

CD146 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD146 Rabbit Polyclonal Antibody
APRab00371-03 100 µL

CD146 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details