Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasminogen-like protein B (PLGB)

This Recombinant Human Plasminogen-like protein B (PLGB) spans the amino acid sequence from region 20-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plasminogen-like protein B; Plasminogen-related protein B; PLGLB1 PLGL PRGB; PLGLB2 PLGP1

UniProt

Q02325

Expression Region

20-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 (2019-nCoV) Spike RBD (F456L) -His Recombinant Protein
E45O54925M2-100 100 µg

SARS-CoV-2 (2019-nCoV) Spike RBD (F456L) -His Recombinant Protein

Sign In for Pricing
View Details
Aurkc ORF Vector (Mouse) (pORF)
ORF039435 1.0 µg DNA

Aurkc ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit RBM22 Antibody
orb1523925-01 10 µL

Rabbit RBM22 Antibody

Sign In for Pricing
View Details
Rabbit RBM22 Antibody
orb1523925-02 100 µL

Rabbit RBM22 Antibody

Sign In for Pricing
View Details
Porcine Lymphocyte antigen 86 ELISA Kit
MBS7271288-01 48 Well

Porcine Lymphocyte antigen 86 ELISA Kit

Sign In for Pricing
View Details
Porcine Lymphocyte antigen 86 ELISA Kit
MBS7271288-02 96 Well

Porcine Lymphocyte antigen 86 ELISA Kit

Sign In for Pricing
View Details