Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 616 (ZN616)

This Recombinant Human Zinc finger protein 616 (ZN616) spans the amino acid sequence from region 1-781. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 616 ZNF616

UniProt

Q08AN1

Expression Region

1-781

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MATQGHLTFKDVAIEFSQEEWKCLEPVQKALYKDVMLENYRNLVFLGISPKCVIKELPPTENSNTGERFQTVALERHQSYDIENLYFREIQKHLHDLEFQWKDGETNDKEVPVPHENNLTGKRDQHSQGDVENNHIENQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHTRGKSYQCDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIHTGEKPYKCNLCGKSFSQRVHLRLHQTVHTGERPFKCNECGKTFKRSSNLTVHQVIHAGKKPYKCDVCGKAFRHRSNLVCHRRIHSGEKQYKCNECGKVFSKRSSLAVHRRIHTVEKPCKCNECGKVFSKRSSLAVHQRIHTGQKTYKCNKCGKVYSKHSHLAVHWRIHTGEKAYKCNECGKVFSIHSRLAAHQRIHTGEKPYKCNECGKVFSQHSRLAVHRRIHTGEKPYKCKECGKVFSDRSAFARHRRIHTGEKPYKCKECGKVFSQCSRLTVHRRIHSGEKPYKCNECGKVYSQYSHLVGHRRVHTGEKPYKCHECGKAFNQGSTLNRHQRIHTGEKPYKCNQCGNSFSQRVHLRLHQTVHTGDRPYKCNECGKTFKRSSNLTAHQIIHAGKKPYKCDECGKVFRHSSHLVSHQRIHTGEKRYKCIECGKAFGRLFSLSKHQRIHSGKKPYKCNECGKSFICRSGLTKHRIRHTGESLTTKLNVTRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-4314 Vector
mh30816 500 ng

LentimiRa-Off-hsa-miR-4314 Vector

Sign In for Pricing
View Details
Sodium pyruvate- (13-C) 3
sc-251048 500 mg

Sodium pyruvate- (13-C) 3

Sign In for Pricing
View Details
Anti-zebrafish Grik1b Antibody, Cy3 Conjugate
DZ33993-Cy3 200 µL/Vial

Anti-zebrafish Grik1b Antibody, Cy3 Conjugate

Sign In for Pricing
View Details
Lenti ORF particles, TXNRD1 (mGFP-tagged) - Human thioredoxin reductase 1 (TXNRD1), transcript variant 3, (Note: selenocystein protein, Internal
RC216045L4V 200 µL

Lenti ORF particles, TXNRD1 (mGFP-tagged) - Human thioredoxin reductase 1 (TXNRD1), transcript variant 3, (Note: selenocystein protein, Internal

Sign In for Pricing
View Details
Bacillus anthracis Spore Antigen (Anthrax) discontinued
B0003-05G8 100 µg

Bacillus anthracis Spore Antigen (Anthrax) discontinued

Sign In for Pricing
View Details
STF-083010 10mg
A16720-10 10 mg

STF-083010 10mg

Sign In for Pricing
View Details