Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human XK-related protein 6 (XKR6), partial

This Recombinant Human XK-related protein 6 (XKR6), partial spans the amino acid sequence from region 494-641. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XK-related protein 6 XKR6 C8orf21 C8orf5 C8orf7 XRG6

UniProt

Q5GH73

Expression Region

494-641

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMED4 activation kit by CRISPRa
GA116655 1 Kit

Human TMED4 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H4 (Ab-16) Antibody
8D0034-AAT 50 µg

Histone H4 (Ab-16) Antibody

Sign In for Pricing
View Details
RELL2 (NM_173828) Human Recombinant Protein
TP308967 20 µg

RELL2 (NM_173828) Human Recombinant Protein

Sign In for Pricing
View Details
IL36RN Rabbit Polyclonal Antibody
TA397111S 25 µL

IL36RN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human/Mouse USP46 Protein
PKSH030764 100 µg

Recombinant Human/Mouse USP46 Protein

Sign In for Pricing
View Details
MINA53 (MINA) Rabbit Monoclonal Antibody
TA422973 100 µL

MINA53 (MINA) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details