Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human XK-related protein 6 (XKR6), partial

This Recombinant Human XK-related protein 6 (XKR6), partial spans the amino acid sequence from region 494-641. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XK-related protein 6 XKR6 C8orf21 C8orf5 C8orf7 XRG6

UniProt

Q5GH73

Expression Region

494-641

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD206 Antibody
GWB-Q01446 0.25 mg

Mouse CD206 Antibody

Sign In for Pricing
View Details
Sheep Vanin 1 ELISA Kit
MBS076386-01 48 Well

Sheep Vanin 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Vanin 1 ELISA Kit
MBS076386-02 96 Well

Sheep Vanin 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Vanin 1 ELISA Kit
MBS076386-03 5x 96 Well

Sheep Vanin 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Vanin 1 ELISA Kit
MBS076386-04 10x 96 Well

Sheep Vanin 1 ELISA Kit

Sign In for Pricing
View Details
Canine Complement C3 Convertase (C3c) ELISA Kit
EIA05400Ca 1 Kit

Canine Complement C3 Convertase (C3c) ELISA Kit

Sign In for Pricing
View Details