Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8G2 (O8G2P), partial

This Recombinant Human Olfactory receptor 8G2 (O8G2P), partial spans the amino acid sequence from region 1-41. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 8G2; Olfactory receptor 8G4; Olfactory receptor OR11-292; Olfactory receptor TPCR120; OR8G2P OR8G2 OR8G4

UniProt

Q6IF36

Expression Region

1-41

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[D-Ala2]-GIP (Human) - I-125 Labeled
T-027-10 10 µCi

[D-Ala2]-GIP (Human) - I-125 Labeled

Sign In for Pricing
View Details
SPINK5 protein, Human, Recombinant (His)
E51P91664 20 µg

SPINK5 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
IL10 (Interleukin 10, CSIF, IL10A, TGIF, Cytokine Synthesis Inhibitory Factor)
363615 200 µL

IL10 (Interleukin 10, CSIF, IL10A, TGIF, Cytokine Synthesis Inhibitory Factor)

Sign In for Pricing
View Details
HSP70/HSC70 Antibody
MBS8001857-01 0.2 mg

HSP70/HSC70 Antibody

Sign In for Pricing
View Details
HSP70/HSC70 Antibody
MBS8001857-02 5x 0.2 mg

HSP70/HSC70 Antibody

Sign In for Pricing
View Details
Rat Anapc4 Pre-designed siRNA Set A
SI200591A 1 Each

Rat Anapc4 Pre-designed siRNA Set A

Sign In for Pricing
View Details