Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 9 (TRGV9)

This Recombinant Human T cell receptor gamma variable 9 (TRGV9) spans the amino acid sequence from region 21-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 9 TRGV9 TCRGV9

UniProt

Q99603

Expression Region

21-122

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: right
CR561102 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
2-Bromophenanthrene
TRC-B678870-5MG 5 mg

2-Bromophenanthrene

Sign In for Pricing
View Details
ST2 Polyclonal Antibody
E-AB-10683-01 20 µL

ST2 Polyclonal Antibody

Sign In for Pricing
View Details
ST2 Polyclonal Antibody
E-AB-10683-02 60 µL

ST2 Polyclonal Antibody

Sign In for Pricing
View Details
ST2 Polyclonal Antibody
E-AB-10683-03 120 µL

ST2 Polyclonal Antibody

Sign In for Pricing
View Details
ST2 Polyclonal Antibody
E-AB-10683-04 200 µL

ST2 Polyclonal Antibody

Sign In for Pricing
View Details