Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 9 (TRGV9)

This Recombinant Human T cell receptor gamma variable 9 (TRGV9) spans the amino acid sequence from region 21-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 9 TRGV9 TCRGV9

UniProt

Q99603

Expression Region

21-122

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGHLEQPQISSTKTLSKTARLECVVSGITISATSVYWYRERPGEVIQFLVSISYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MBD3L2 activation kit by CRISPRa
GA114906 1 Kit

Human MBD3L2 activation kit by CRISPRa

Sign In for Pricing
View Details
D-Fructose 1,6-Biphosphate Dicalcium Salt
TRC-F792535-1G 1 g

D-Fructose 1,6-Biphosphate Dicalcium Salt

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), Biotin conjugate, 0.1mg/mL
BNCB2551-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIGG (NM_001289051) Human Tagged ORF Clone
RG239747 10 µg

PIGG (NM_001289051) Human Tagged ORF Clone

Sign In for Pricing
View Details
Fucose BSA Colloidal Gold Conjugate,  40nm
CCG-0004-40 1 mL

Fucose BSA Colloidal Gold Conjugate, 40nm

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]
E-AB-F1411J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD138/Syndecan-1 Antibody[B-B4]

Sign In for Pricing
View Details