Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative pro-MCH-like protein 2 (MCHL2)

This Recombinant Human Putative pro-MCH-like protein 2 (MCHL2) spans the amino acid sequence from region 1-86. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative pro-MCH-like protein 2; Pro-melanin-concentrating hormone-like protein 2; PMCHL2

UniProt

Q9BQD1

Expression Region

1-86

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Apolipoprotein A-2, APO-A2 ELISA KIT
EA0085Ra-01 96 Well

Rat Apolipoprotein A-2, APO-A2 ELISA KIT

Sign In for Pricing
View Details
ASPP1 (PPP1R13B) (NM_015316) Human Tagged ORF Clone
RG221172 10 µg

ASPP1 (PPP1R13B) (NM_015316) Human Tagged ORF Clone

Sign In for Pricing
View Details
PMS2 Antibody
37216 100 µL

PMS2 Antibody

Sign In for Pricing
View Details
IGSF11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D2]
TA803762BM 100 µL

IGSF11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D2]

Sign In for Pricing
View Details
SDPR Rabbit Polyclonal Antibody (APC)
orb1001624 100 µL

SDPR Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
G Protein Coupled Receptor 109B (GPR109B) Antibody
abx176527-01 200 µg

G Protein Coupled Receptor 109B (GPR109B) Antibody

Sign In for Pricing
View Details