Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cAMP-dependent protein kinase inhibitor gamma (IPKG)

This Recombinant Human cAMP-dependent protein kinase inhibitor gamma (IPKG) spans the amino acid sequence from region 1-76. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAMP-dependent protein kinase inhibitor gamma; PKI-gamma; PKIG

UniProt

Q9Y2B9

Expression Region

1-76

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3C Polyclonal Antibody
E-AB-52777-01 20 µL

EIF3C Polyclonal Antibody

Sign In for Pricing
View Details
EIF3C Polyclonal Antibody
E-AB-52777-02 60 µL

EIF3C Polyclonal Antibody

Sign In for Pricing
View Details
EIF3C Polyclonal Antibody
E-AB-52777-03 120 µL

EIF3C Polyclonal Antibody

Sign In for Pricing
View Details
EIF3C Polyclonal Antibody
E-AB-52777-04 200 µL

EIF3C Polyclonal Antibody

Sign In for Pricing
View Details
Iron(III) Bromide
TRC-I774955-1G 1 g

Iron(III) Bromide

Sign In for Pricing
View Details
IL20RA Polyclonal Antibody
E-AB-10109-01 20 µL

IL20RA Polyclonal Antibody

Sign In for Pricing
View Details