Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1)

This Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1) spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein KIF25-AS1; KIF25 antisense RNA 1; KIF25 antisense gene protein 1; Protein HGC6.1; KIF25-AS1 C6orf54 NCRNA00300

UniProt

Q9Y6Z4

Expression Region

1-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDIFKNNGVLQGRLRAVACAPHCFGPRLRCLHHDQGLTELAWGTWPHSHPVRHQPQMPSARECCSIVCMAAKEVSAPKAPGSPWMVPGDVAMSGHRVGALDERGHPNPQTGHCRGGSVSVTWSSVSCCRGRLAAVRVMIARDPSTCHLAKGCSPAWGFLPQARGPAGTRTPQRRCSSHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G CSF (CSF3) Human Gene Knockout Kit (CRISPR)
KN207709LP 1 Kit

G CSF (CSF3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF740 conjugate, 0.1mg/mL
BNC741199-500 1x 500 µL

SUMO-2 (SUMO2/1199), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament Medium Antibody
OC-832-01 50 μL

Neurofilament Medium Antibody

Sign In for Pricing
View Details
Neurofilament Medium Antibody
OC-832-02 100 µL

Neurofilament Medium Antibody

Sign In for Pricing
View Details
Neurofilament Medium Antibody
OC-832-03 1 mL

Neurofilament Medium Antibody

Sign In for Pricing
View Details
3-Benzoylpropanoic Acid
TRC-B208800-5G 5 g

3-Benzoylpropanoic Acid

Sign In for Pricing
View Details