Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 265 (TM265), partial

This Recombinant Human Transmembrane protein 265 (TM265), partial spans the amino acid sequence from region 1-33. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 265 TMEM265

UniProt

A0A087WTH1

Expression Region

1-33

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP13A5 (m) -PR
sc-141342-PR 10 µM - 20 µL

ATP13A5 (m) -PR

Sign In for Pricing
View Details
UQCRH (NM_006004) Human Tagged ORF Clone Lentiviral Particle
RC201258L1V 200 µL

UQCRH (NM_006004) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPL5 Antibody, FITC conjugated
A37542-100UG 100 µg

RPL5 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi Isoleucine--tRNA ligase (ileS), partial
MBS1376518 Inquire

Recombinant Pyrococcus abyssi Isoleucine--tRNA ligase (ileS), partial

Sign In for Pricing
View Details
TSSC4 Antibody - middle region : Biotin (ARP52089_P050-Biotin)
ARP52089_P050-Biotin 100 µL

TSSC4 Antibody - middle region : Biotin (ARP52089_P050-Biotin)

Sign In for Pricing
View Details
Cavy GM2 Ganglioside Activator ELISA Kit
MBS094630 Inquire

Cavy GM2 Ganglioside Activator ELISA Kit

Sign In for Pricing
View Details