Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PIK3R3 upstream open reading frame protein (P3URF)

This Recombinant Human PIK3R3 upstream open reading frame protein (P3URF) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PIK3R3 upstream open reading frame protein P3R3URF

UniProt

A0A087WWA1

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGPSRLVRGPRPQGMRSPYRRPGMGWPRPRFPRMFKCSRRRYQQGLRGRTASSAAINPATRAMGINNTHTDTTIVWIFPPQVLRHLRQPGIFLIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA14 (RPA3) Human Over-expression Lysate
orb1358158 100 µg

RPA14 (RPA3) Human Over-expression Lysate

Sign In for Pricing
View Details
Wdr62 3'UTR Lenti-reporter-Luc Vector
50354084 1.0 µg

Wdr62 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PE/Cy5 Anti-human CD45 Antibody *2D1*
104541M1-AAT 100 Tests

PE/Cy5 Anti-human CD45 Antibody *2D1*

Sign In for Pricing
View Details
Anti-SLC6A7 Antibody Picoband®
A14103-1-carrier-free 100 µg/Vial

Anti-SLC6A7 Antibody Picoband®

Sign In for Pricing
View Details
Calcitonin; CALCA Protein (C-His, Human)
P513615 100 µg

Calcitonin; CALCA Protein (C-His, Human)

Sign In for Pricing
View Details
RBM34 Rabbit Polyclonal Antibody
orb577780 100 µL

RBM34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details