Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01)

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01) spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRYBB1 Protein Vector (Rat) (pPB-N-His)
PV261863 500 ng

CRYBB1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Elovl3 3'UTR Lenti-reporter-Luc Vector
19235084 1.0 µg

Elovl3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit
DLR-NOS1-Hu-01 48 Tests

Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit

Sign In for Pricing
View Details
Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit
DLR-NOS1-Hu-02 96 Tests

Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit

Sign In for Pricing
View Details
Human CP/Ceruloplasmin ELISA Kit
E0542Hu 96 Tests

Human CP/Ceruloplasmin ELISA Kit

Sign In for Pricing
View Details
Human RNASEL Pre-designed siRNA Set B
SI013824B 1 Each

Human RNASEL Pre-designed siRNA Set B

Sign In for Pricing
View Details