Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01)

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01) spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Prokineticin-1 (PROK1) ELISA
KBH4173 1x 96 Well

GENLISA™ Human Prokineticin-1 (PROK1) ELISA

Sign In for Pricing
View Details
Epirubicin 50mg
A12409-50 50 mg

Epirubicin 50mg

Sign In for Pricing
View Details
Cyclamic Acid
sc-211150A 50 g

Cyclamic Acid

Sign In for Pricing
View Details
ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (MaxLight 750) discontinued
243264-ML750 100 µL

ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MIR6339 Mouse MicroRNA Expression Plasmid (MI0021867)
SC402671 10 µg

MIR6339 Mouse MicroRNA Expression Plasmid (MI0021867)

Sign In for Pricing
View Details
SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 750)
MBS6394958-01 0.1 mL

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 750)

Sign In for Pricing
View Details