Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MMP24OS (MMPOS)

This Recombinant Human Protein MMP24OS (MMPOS) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MMP24OS; MMP24 opposite strand; MMP24OS MMP24-AS1

UniProt

A0A0U1RRL7

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RbAp46 (RBBP7) (NM_002893) Human Over-expression Lysate
LH06413V 100 µg

RbAp46 (RBBP7) (NM_002893) Human Over-expression Lysate

Sign In for Pricing
View Details
CD127/IL7R Protein (N-His, Human)
P501480 100 µg

CD127/IL7R Protein (N-His, Human)

Sign In for Pricing
View Details
Endoglycan (PODXL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E1]
TA810169BM 100 µL

Endoglycan (PODXL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E1]

Sign In for Pricing
View Details
Gm5150 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3007407 1.0 µg DNA

Gm5150 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Kcnk12 Pre-designed siRNA Set A
SI107061A 1 Each

Mouse Kcnk12 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Tyrosyl-DNA Phosphodiesterase 1,TDP1 ELISA KIT
JOT-EK6368Hu-01 96 Well

Human Tyrosyl-DNA Phosphodiesterase 1,TDP1 ELISA KIT

Sign In for Pricing
View Details