Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MMP24OS (MMPOS)

This Recombinant Human Protein MMP24OS (MMPOS) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MMP24OS; MMP24 opposite strand; MMP24OS MMP24-AS1

UniProt

A0A0U1RRL7

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Soluble calcium-activated nucleotidase 1, CANT1 ELISA KIT
ELI-50383h 96 Tests

Human Soluble calcium-activated nucleotidase 1, CANT1 ELISA KIT

Sign In for Pricing
View Details
SSX4
CSB-CL022736HU1 10 μg Plasmid + 200 μL Glycerol

SSX4

Sign In for Pricing
View Details
Ipfencarbazone
MBS5756037 Inquire

Ipfencarbazone

Sign In for Pricing
View Details
Human ADAMTS-like protein 1 (ADAMTSL1) ELISA Kit
AE23853HU-01 48 Tests

Human ADAMTS-like protein 1 (ADAMTSL1) ELISA Kit

Sign In for Pricing
View Details
Human ADAMTS-like protein 1 (ADAMTSL1) ELISA Kit
AE23853HU-02 96 Tests

Human ADAMTS-like protein 1 (ADAMTSL1) ELISA Kit

Sign In for Pricing
View Details
RBM10 Antibody
C45819-01 50 µL

RBM10 Antibody

Sign In for Pricing
View Details