Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 6A (LCE6A)

This Recombinant Human Late cornified envelope protein 6A (LCE6A) spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 6A LCE6A C1orf44

UniProt

A0A183

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin A (HRP) discontinued
C8452-38-HRP 100 µL

Cyclin A (HRP) discontinued

Sign In for Pricing
View Details
PAR-2 Biosimilar (Amgen patent PAR2 Reference Antibody)
orb2704034-01 1 mg

PAR-2 Biosimilar (Amgen patent PAR2 Reference Antibody)

Sign In for Pricing
View Details
PAR-2 Biosimilar (Amgen patent PAR2 Reference Antibody)
orb2704034-02 5 mg

PAR-2 Biosimilar (Amgen patent PAR2 Reference Antibody)

Sign In for Pricing
View Details
PAR-2 Biosimilar (Amgen patent PAR2 Reference Antibody)
orb2704034-03 100 mg

PAR-2 Biosimilar (Amgen patent PAR2 Reference Antibody)

Sign In for Pricing
View Details
Mouse Macrod2 (NM_028387) AAV Particle
MR200464A1V 250 µL

Mouse Macrod2 (NM_028387) AAV Particle

Sign In for Pricing
View Details
Mrpl38 AAV siRNA Pooled Vector
30480166 1.0 µg

Mrpl38 AAV siRNA Pooled Vector

Sign In for Pricing
View Details