Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial

This Recombinant Human Transmembrane protein 272 (TM272), partial spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOSC9 Recombinant Rabbit Monoclonal Antibody [PSH08-55]
HA723001 100 µL

EXOSC9 Recombinant Rabbit Monoclonal Antibody [PSH08-55]

Sign In for Pricing
View Details
Fexofenadinone
TRC-F322520-1G 1 g

Fexofenadinone

Sign In for Pricing
View Details
UGT8 Rabbit Polyclonal Antibody
AP05205PU-N 100 µg

UGT8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCDHGB6 Human Gene Knockout Kit (CRISPR)
KN416903 1 Kit

PCDHGB6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FE65 (APBB1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]
CF811192 100 µg

FE65 (APBB1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS701096 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details