Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 272 (TM272), partial

This Recombinant Human Transmembrane protein 272 (TM272), partial spans the amino acid sequence from region 73-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 272 TMEM272

UniProt

A0A1B0GTI8

Expression Region

73-106

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Heat Shock Protein 70, Hsp-70 Elisa Kit
EKC39165 96 Tests

Rat Heat Shock Protein 70, Hsp-70 Elisa Kit

Sign In for Pricing
View Details
Pafah2 siRNA Oligos set (Mouse)
35937174 3x 5 nmol

Pafah2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Spag11c ORF Vector (Rat) (pORF)
45180016 1.0 µg DNA

Spag11c ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRF3 Polyclonal Antibody
MBS9016452 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRF3 Polyclonal Antibody

Sign In for Pricing
View Details
Trappc2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3182807 1.0 µg DNA

Trappc2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
OR5AU1 Antibody
MBS853174-01 0.1 mg

OR5AU1 Antibody

Sign In for Pricing
View Details