Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epididymal protein 13 (EDD13)

This Recombinant Human Epididymal protein 13 (EDD13) spans the amino acid sequence from region 24-161. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymal protein 13 EDDM13

UniProt

A0A1B0GTR0

Expression Region

24-161

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTPREVATKEKINLLKGIIGLMSRLSPDGLRHNITSLKMPPLVSPQDRTEEEIKKILGLLSLQVLHEETSGCKEEVKPFSGTTPSRKPLPKRKNTWNFLKCAYMVMTYLFVSYNKGDWCYCHYCNLELDIRDDPCCSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YPL182C Antibody
orb850488 2 mg

YPL182C Antibody

Sign In for Pricing
View Details
Recombinant Haematococcus pluvialis Beta-carotene 3-hydroxylase, chloroplastic (CRTZ), partial
MBS7098953 Inquire

Recombinant Haematococcus pluvialis Beta-carotene 3-hydroxylase, chloroplastic (CRTZ), partial

Sign In for Pricing
View Details
Cluster Of Differentiation 19 (CD19) Monoclonal Antibody
CAU35889-01 100 µL

Cluster Of Differentiation 19 (CD19) Monoclonal Antibody

Sign In for Pricing
View Details
Cluster Of Differentiation 19 (CD19) Monoclonal Antibody
CAU35889-02 200 µL

Cluster Of Differentiation 19 (CD19) Monoclonal Antibody

Sign In for Pricing
View Details
Cluster Of Differentiation 19 (CD19) Monoclonal Antibody
CAU35889-03 1 mL

Cluster Of Differentiation 19 (CD19) Monoclonal Antibody

Sign In for Pricing
View Details
RHOBTB1 (NM_198225) Human Over-expression Lysate
LH16205V 100 µg

RHOBTB1 (NM_198225) Human Over-expression Lysate

Sign In for Pricing
View Details