Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epididymal protein 13 (EDD13)

This Recombinant Human Epididymal protein 13 (EDD13) spans the amino acid sequence from region 24-161. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymal protein 13 EDDM13

UniProt

A0A1B0GTR0

Expression Region

24-161

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTPREVATKEKINLLKGIIGLMSRLSPDGLRHNITSLKMPPLVSPQDRTEEEIKKILGLLSLQVLHEETSGCKEEVKPFSGTTPSRKPLPKRKNTWNFLKCAYMVMTYLFVSYNKGDWCYCHYCNLELDIRDDPCCSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myoglobin, Recombinant, Mouse, aa2-154, His-Tag, Myc-Tag
585457 20 µg

Myoglobin, Recombinant, Mouse, aa2-154, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Rtn4rl2 Mouse qPCR Primer Pair (NM_199223)
MP212675 200 Reactions

Rtn4rl2 Mouse qPCR Primer Pair (NM_199223)

Sign In for Pricing
View Details
RPL32P31 3'UTR Lenti-reporter-Luc Vector
41436081 1.0 µg

RPL32P31 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ATL3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV682661 1.0 µg DNA

ATL3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
BCL10
307748-01 50 µL

BCL10

Sign In for Pricing
View Details
BCL10
307748-02 100 µL

BCL10

Sign In for Pricing
View Details