Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial

This Recombinant Human Testis-expressed protein 50 (TEX50), partial spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-149-3p Primers
MPR00404 150 µL / 10 µM

rno-miR-149-3p Primers

Sign In for Pricing
View Details
Gjb5 Rat shRNA Plasmid (Locus ID 29586)
TL710254 1 Kit

Gjb5 Rat shRNA Plasmid (Locus ID 29586)

Sign In for Pricing
View Details
mmu-miR-1968-3p miRNA Inhibitor
MIM01411 2x 5.0 nmol

mmu-miR-1968-3p miRNA Inhibitor

Sign In for Pricing
View Details
Canine Ubiquitin carboxyl-terminal hydrolase 28 (USP28) ELISA Kit
MBS7214575-01 48 Well

Canine Ubiquitin carboxyl-terminal hydrolase 28 (USP28) ELISA Kit

Sign In for Pricing
View Details
Canine Ubiquitin carboxyl-terminal hydrolase 28 (USP28) ELISA Kit
MBS7214575-02 96 Well

Canine Ubiquitin carboxyl-terminal hydrolase 28 (USP28) ELISA Kit

Sign In for Pricing
View Details
Canine Ubiquitin carboxyl-terminal hydrolase 28 (USP28) ELISA Kit
MBS7214575-03 5x 96 Well

Canine Ubiquitin carboxyl-terminal hydrolase 28 (USP28) ELISA Kit

Sign In for Pricing
View Details