Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48)

This Recombinant Human Testis-expressed protein 48 (TEX48) spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Polyamine Oxidase ELISA Kit
MBS084144 Inquire

Cavy Polyamine Oxidase ELISA Kit

Sign In for Pricing
View Details
Recombinant Schistosoma Japonicum GST
PEV0739-01 10 µg

Recombinant Schistosoma Japonicum GST

Sign In for Pricing
View Details
Recombinant Schistosoma Japonicum GST
PEV0739-02 50 µg

Recombinant Schistosoma Japonicum GST

Sign In for Pricing
View Details
Recombinant Schistosoma Japonicum GST
PEV0739-03 500 µg

Recombinant Schistosoma Japonicum GST

Sign In for Pricing
View Details
C7orf33 Antibody, Biotin conjugated
A63496-100UG 100 µg

C7orf33 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3) (Azide Free) (MaxLight 750) discontinued
T2140-04-ML750 100 µL

TEAD4 (Transcriptional Enhancer Factor TEF-3, TEA Domain Family Member 4, TEAD-4, Transcription Factor RTEF-1, Transcription Factor 13-like 1, RTEF1, TCF13L1, TEF3) (Azide Free) (MaxLight 750) discontinued

Sign In for Pricing
View Details