Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MARCO-like protein (MRCOL)

This Recombinant Human MARCO-like protein (MRCOL) spans the amino acid sequence from region 21-285. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MARCO-like protein MARCOL

UniProt

A0A1B0GUY1

Expression Region

21-285

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QISNTSVFKLEENPKPALILEEKNEANHLGGQRDSNKQGGSYTQGNPGTFRLQGQPGYFNKLEKPRHFKQGRAGVLNQPGILKNSGKSNQKGNPESSNKQENSGSSSQLGRPGISTQQGNPGSSDQQEKPGSFSQKVMVGSSSQQGKPGSSSQHGNLGSSTQKGNLGSSSLQGHLGLSSHQGKPESSGQQGKPGSSSQQGNLGTSGQQEKPGSSSQQGKPGLSSHQGKPGSSSQQGNLHLSSQQGNQGPSSKQRKPGSSSRQGNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOB1 Antibody
orb846232 2 mg

FOB1 Antibody

Sign In for Pricing
View Details
Whatman No. 541 240mm Filter Paper circles
FIL2318 100 / PCK

Whatman No. 541 240mm Filter Paper circles

Sign In for Pricing
View Details
SPC (Pulmonary Surfactant Associated Protein C) BioAssayTM ELISA Kit (Rat) discontinued
384484 96 Tests

SPC (Pulmonary Surfactant Associated Protein C) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
HEI10 Antibody
orb2677139-01 50 µL

HEI10 Antibody

Sign In for Pricing
View Details
HEI10 Antibody
orb2677139-02 100 µL

HEI10 Antibody

Sign In for Pricing
View Details
HEI10 Antibody
orb2677139-03 200 µL

HEI10 Antibody

Sign In for Pricing
View Details