Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C2orf92 (CB092), partial

This Recombinant Human Uncharacterized protein C2orf92 (CB092), partial spans the amino acid sequence from region 21-191. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C2orf92; Long intergenic non-protein coding RNA 1125; C2orf92 LINC01125

UniProt

A0A1B0GVN3

Expression Region

21-191

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVFSKVPYDPSFDETRTAVRSITKRDTQKSYSQQKSLNNAAFASGSNEREEHLAKIFDEILLQVFPKFPYDPSFNEATAVRSITKTDMRKGTSIAWNSPKPEYFLGSVDKIPDKDHLSEEKNFKESCLFDRDLREQLTTIDKETLQGAAKPDAHFRTMPCGQLLHFLQRNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sfmbt2 Mouse Gene Knockout Kit (CRISPR)
KN515650 1 Kit

Sfmbt2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Optitrol NAT CT/NG
NT02012 10x 1.2 mL

Optitrol NAT CT/NG

Sign In for Pricing
View Details
3-Nitro-4-toluidine
TRC-N572500-5G 5 g

3-Nitro-4-toluidine

Sign In for Pricing
View Details
Screw-cap MicroCentrifuge Tubes
C3215-SG 1000 Units/Case

Screw-cap MicroCentrifuge Tubes

Sign In for Pricing
View Details
p62 Antibody SQSTM1 (phospho-S207)
F48756-0.08ML 0.08 mL

p62 Antibody SQSTM1 (phospho-S207)

Sign In for Pricing
View Details
Cytokeratin, HMW (34BE12), CF405S conjugate, 0.1mg/mL
BNC040446-100 1x 100 µL

Cytokeratin, HMW (34BE12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details